PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01016309001
Common NameLOC100240985, VIT_13s0019g04010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family MYB
Protein Properties Length: 1383aa    MW: 152444 Da    PI: 6.5347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01016309001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-09659700346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +WT+eE e++ d  + +G++ +k+Ia+ +  ++t  +c+++++k
  GSVIVT01016309001 659 PWTAEEKEIFMDKLAIFGKE-FKKIASFLD-HKTTADCVEFYYK 700
                        8*******************.*********.***********98 PP

2Myb_DNA-binding32.61.9e-10878917445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT eE  ++v+av  +G++ +++I+r++  +R++ qck ++ 
  GSVIVT01016309001 878 WTDEEKCIFVQAVSSYGKD-FAKISRCVR-TRSRDQCKVFFS 917
                        *****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-14642703IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-6652701IPR009057Homeodomain-like
PROSITE profilePS5129315.504655706IPR017884SANT domain
SMARTSM007174.4E-8656704IPR001005SANT/Myb domain
PfamPF002491.6E-6658700IPR001005SANT/Myb domain
PROSITE profilePS5129312.014873924IPR017884SANT domain
SMARTSM007173.2E-9874922IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-10876924IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-6877918IPR009057Homeodomain-like
CDDcd001674.58E-8878916No hitNo description
PfamPF002492.6E-8878917IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1383 aa     Download sequence    Send to blast
MIYYIIHFYK KHERSESLGF SARWRDSHQG SREFARWGSA EVRRPPGHGK QGGWHIFPEE  60
SGHGFVPSRS SDKMVEDENS RPFTTRGDGN GKYSRNNREI RGSFSQKDWK GHPLETGNAS  120
PNMSGRSLAI NDQRSVDDML IHSDFVNGWD QLQLKDQHDK MGSVNGLGTG QRAERENSLS  180
SIDWKPLKWT RSGSLSSRGS GFSHSSSSKS MGVDSNEARG DLQPRNVTPV QSPSGDAVAC  240
VASTAPSEET SSRKKPRLGW GEGLAKYERK KVEGPDESVN KNGIVFCTSN GESTHSLNSN  300
LADKSPRVMG FSDCASPATP SSVACSSSPG MEEKSFSKAG NVDNDTSTLS GSPGPVSLNH  360
LDGFSFILES LEPNQIANLG FSPIELLQSD DPSSVDSNFM RSTAMSKLLI WKGDISKSLE  420
MTESEIDTLE NELKSLKSGP GTATSKFVEP PCLTGISTSG GDSRLLIYNL ILASNKDCAN  480
RASEVFNKLL PQNQCQNDIL GAANFACRQN DSLIKQKFAM RKRFLRFKEK VITLKFRVSQ  540
HVWKEDMRLL SIRKYRAKSQ KKFELSLRTS HCGYQKHRSS IRSRFSSPAG NLSPVPTAEM  600
INYTSKMLSE SQMKLCRNIL KMPALILDKK EKTASRFISS NGLVEDPCAV ENERTMINPW  660
TAEEKEIFMD KLAIFGKEFK KIASFLDHKT TADCVEFYYK NHKSDCFEKT KKKLELRKQG  720
KSLSATTYLV TSGKKWNREM NAASLDMLGA ASVMAARAGD SMENLQTCPG KFLLGAHHDY  780
RTPHGDNGVV ERSSSYDIIR NERETVAADV LAGICGSLSS EAMSSCITSS LDPGEGYREL  840
RQKVGSGVKR PLTPEVTQSI DEETCSDESC GEMDPADWTD EEKCIFVQAV SSYGKDFAKI  900
SRCVRTRSRD QCKVFFSKAR KCLGLDLIHP GPNVGTPESD DANGGGSDTE DACVVEAGSV  960
ICSNKSGSKM EEDSLLSVLN INPDESDFSG MKNLQTDLNR SYENNGIGRV DHKDDETVTN  1020
LVSDKCHQLE KTEQVFGDSN SLNGIDSKSL TLHVEKNGPC TKMEMDHESV SAVEATDPSD  1080
RSNAVSQAED LTEGNLLPET SLNVRREENN DADTSGQMSL KCTVKDSEVK ENALHQVPNS  1140
TSCPRFIFNS GCQDQVSVEL DNQKPGVISL LQESSLMAED SVPKDSSVIQ YEKTLDQGMS  1200
PSTLDLKETK DKNKSIGVDE YHQHLSGHSL LNNAVNAEFC KNPSSAAERL SKLDRDIQSS  1260
HSLAQDCYLQ KCNGSKSHSL GTELPFLSQS LERTSNQTRA HGRSLSDTEK TSRNGDFKLF  1320
GQILSHPPSL QNPNSCSNEN DDKGAHNPKL SSKSVNLKFT ESSHELWFLG WEQDTNRFLI  1380
IT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14617708494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14617708494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253269KKPRLGWGEGLAKYERK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.168650.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4416480.0AM441648.2 Vitis vinifera contig VV78X099344.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658422.10.0PREDICTED: uncharacterized protein LOC100240985 isoform X1
TrEMBLF6HNI10.0F6HNI1_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-147MYB family protein